# hmmsearch :: search profile(s) against a sequence database # HMMER 3.0 (March 2010); http://hmmer.org/ # Copyright (C) 2010 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: Terpene_synth_N.hmm # target sequence database: Capsella-rubella.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Terpene_synth_N-terminal [M=192] Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-54 185.3 0.0 4.5e-54 183.7 0.0 1.9 1 XP_006289666.1 hypothetical protein CARUB_v10003225mg [Capse 6.2e-51 173.5 0.5 1.3e-50 172.4 0.4 1.6 1 XP_006304764.1 hypothetical protein CARUB_v10012239mg [Capse 6.3e-51 173.5 0.2 1.1e-50 172.7 0.2 1.4 1 XP_006299882.1 hypothetical protein CARUB_v10016089mg [Capse 1.3e-50 172.5 0.8 3.1e-50 171.2 0.5 1.7 1 XP_006299223.1 hypothetical protein CARUB_v10015372mg [Capse 5.4e-50 170.4 0.6 9.7e-50 169.6 0.4 1.4 1 XP_006304837.1 hypothetical protein CARUB_v10012518mg [Capse 1e-49 169.5 1.0 1e-49 169.5 0.7 1.9 2 XP_006279831.1 hypothetical protein CARUB_v10028174mg [Capse 3.5e-49 167.8 5.2 1.4e-48 165.8 0.6 2.5 2 XP_006286118.1 hypothetical protein CARUB_v10007667mg [Capse 3.8e-49 167.7 0.9 3.8e-49 167.7 0.6 1.6 1 XP_006279816.1 hypothetical protein CARUB_v10028094mg [Capse 5.6e-48 163.8 0.2 1.1e-47 162.9 0.1 1.5 1 XP_006285692.1 hypothetical protein CARUB_v10007162mg [Capse 8.2e-48 163.3 0.4 1.3e-47 162.7 0.3 1.3 1 XP_006300014.1 hypothetical protein CARUB_v10016237mg [Capse 1.2e-47 162.8 0.2 2.4e-47 161.8 0.0 1.6 2 XP_006295697.1 hypothetical protein CARUB_v10024815mg, parti 3.4e-47 161.3 1.3 5.2e-47 160.7 0.9 1.3 1 XP_006282404.1 hypothetical protein CARUB_v100281680mg, part 1.5e-46 159.2 0.8 3.4e-46 158.0 0.2 1.9 1 XP_006287438.1 hypothetical protein CARUB_v10000642mg [Capse 2.3e-46 158.6 0.0 5.1e-46 157.4 0.0 1.6 1 XP_006300940.1 hypothetical protein CARUB_v10021320mg [Capse 3.5e-46 158.0 1.1 7e-46 157.0 0.5 1.7 1 XP_006289905.1 hypothetical protein CARUB_v10003521mg [Capse 4.5e-46 157.6 1.4 6e-46 157.2 0.2 1.8 2 XP_006281945.1 hypothetical protein CARUB_v10028157mg [Capse 7.6e-46 156.9 0.1 1.3e-45 156.2 0.1 1.3 1 XP_006282975.1 hypothetical protein CARUB_v100067221mg, part 8e-46 156.8 1.9 1e-45 156.4 1.3 1.1 1 XP_006304904.1 hypothetical protein CARUB_v100116241mg, part 1.4e-45 156.0 1.9 2.5e-45 155.2 1.3 1.4 1 XP_006304827.1 hypothetical protein CARUB_v10012477mg [Capse 4.6e-45 154.3 0.0 1.2e-44 153.0 0.0 1.8 1 XP_006301661.1 hypothetical protein CARUB_v10022111mg [Capse 6.8e-45 153.8 0.9 9.8e-45 153.3 0.6 1.2 1 XP_006281703.1 hypothetical protein CARUB_v10027853mg, parti 1.8e-44 152.4 1.1 3.4e-44 151.5 0.7 1.5 1 XP_006292580.1 hypothetical protein CARUB_v10018817mg [Capse 2.6e-43 148.6 0.3 1.1e-42 146.5 0.0 2.1 2 XP_006300764.1 hypothetical protein CARUB_v10019830mg [Capse 7.3e-43 147.1 1.3 7.3e-43 147.1 0.9 1.9 2 XP_006293887.1 hypothetical protein CARUB_v10022874mg [Capse 1.2e-41 143.2 5.8 1.2e-41 143.2 4.0 1.6 1 XP_006293874.1 hypothetical protein CARUB_v10022869mg [Capse 7.9e-40 137.3 1.6 1.7e-39 136.1 1.0 1.6 1 XP_006283443.1 hypothetical protein CARUB_v10004490mg [Capse 8.7e-40 137.1 7.5 1.9e-39 136.0 5.2 1.6 1 XP_006283392.1 hypothetical protein CARUB_v10004436mg [Capse 9.2e-40 137.0 3.5 1.5e-39 136.4 2.4 1.3 1 XP_006292532.1 hypothetical protein CARUB_v10018762mg [Capse 1e-39 136.9 8.3 2e-39 135.9 5.2 1.9 2 XP_006283393.1 hypothetical protein CARUB_v10004436mg [Capse 1.4e-37 129.9 0.4 2.7e-37 129.0 0.3 1.4 1 XP_006301761.1 hypothetical protein CARUB_v10022222mg [Capse 2.3e-36 125.9 0.3 2.3e-36 125.9 0.2 2.0 1 XP_006301504.1 hypothetical protein CARUB_v10021930mg [Capse 8.4e-34 117.6 0.6 2.6e-33 116.0 0.0 2.0 2 XP_006300608.1 hypothetical protein CARUB_v10019776mg [Capse 7.1e-21 75.4 0.0 8.6e-21 75.2 0.0 1.1 1 XP_006290473.1 hypothetical protein CARUB_v100190721mg, part 1.6e-20 74.2 0.1 3.5e-20 73.2 0.1 1.6 1 XP_006301362.1 hypothetical protein CARUB_v10021772mg, parti 5.9e-19 69.2 0.1 1e-18 68.4 0.0 1.4 1 XP_006293315.1 hypothetical protein CARUB_v100190720mg, part 2.9e-16 60.4 0.0 5.1e-16 59.6 0.0 1.3 1 XP_006301390.1 hypothetical protein CARUB_v10021803mg [Capse ------ inclusion threshold ------ 0.2 12.0 0.2 10 6.4 0.0 2.2 2 XP_006294378.1 hypothetical protein CARUB_v10023396mg [Capse Domain annotation for each sequence (and alignments): >> XP_006289666.1 hypothetical protein CARUB_v10003225mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 183.7 0.0 5.8e-57 4.5e-54 1 191 [. 242 447 .. 242 448 .. 0.86 Alignments for each domain: == domain 1 score: 183.7 bits; conditional E-value: 5.8e-57 --------------------------------......----------------------------------------------- CS Terpene_synth_N-terminal 1 dwgdvfllslkngslfnspsataealeeeaek......lkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiL 79 dw++ ++l+ ++gs++ sps+ta a++ ++++ l++ v++ +vp+v p+dl+e+++++d+LqrLGis++FeeeIke+L XP_006289666.1 242 DWEKLLKLQSQDGSFLFSPSSTAFAFM-QTRDsnclgyLRNAVKRFNGGVPNVFPVDLFEHIWIVDRLQRLGISRYFEEEIKECL 325 7**********************99**.555559*9999999999888************************************* PP -----------------.....---------------------------------------.--...------------------ CS Terpene_synth_N-terminal 80 deiyrsweekkseeeed.....dletvAlaFrLLRqhGydvssdvFkkFkdeegnfkesls.ed...vkgllsLYeAshlstege 155 d+++r+w++ k+ ++++ d++++A+aFrLLR hGy+vs dvFk+F++e + f +++ ++ v+g+++LY+As+l++++e XP_006289666.1 326 DYVHRYWTD-KGICWARcshvqDIDDTAMAFRLLRLHGYQVSADVFKNFEKEGE-F-FCFVgQSnqaVTGMFNLYRASQLAFPRE 407 ********9.667787788899***************************96555.6.5666433667****************** PP ----------------------.--..---.--------- CS Terpene_synth_N-terminal 156 eiLeealsFtrkhLkeslseel.sd..esp.nlaeeVeha 191 +iL++a++F+ ++L+++ ++e+ d ++ +l e+ a XP_006289666.1 408 DILKNAKDFSYNYLQDKREREElLDkwIIMkDLPGEIGFA 447 **************87544443222463333677777666 PP >> XP_006304764.1 hypothetical protein CARUB_v10012239mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 172.4 0.4 1.7e-53 1.3e-50 2 192 .] 79 262 .. 78 262 .. 0.87 Alignments for each domain: == domain 1 score: 172.4 bits; conditional E-value: 1.7e-53 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wg++fl s + + ++ +al+ e+e+lk++vr++++ +++ k++++++ +i L +LG++yhFe+eI+e+L++ +r++ XP_006304764.1 79 WGHQFL-SAHVDL------SEMDALRIEIETLKPKVRDMFMLSSE-GIKSTKKNIMFIYLLVSLGLAYHFEDEIEEALRDGFRKM 155 999999.444444......35599999*************84444.55777799******************************* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 ee++ + eddl+tv++ F ++R++G+++ssdvFkkFk ++g+fke+l++d kg+lsLYeA+h++t++++iL+ea+sF+++hL+e XP_006304764.1 156 EEEDMMSGEDDLYTVSIVFLVFRTYGHNISSDVFKKFKGDNGKFKECLARDPKGILSLYEAAHMGTTTDYILDEAMSFAKSHLEE 240 9986566667*************************************************************************99 PP -----------.---------- CS Terpene_synth_N-terminal 172 slseelsdesp.nlaeeVehaL 192 +s + + + nl++++ +aL XP_006304764.1 241 FSSAAANGSCKrNLSRRILKAL 262 5554444444559999998887 PP >> XP_006299882.1 hypothetical protein CARUB_v10016089mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 172.7 0.2 1.4e-53 1.1e-50 2 192 .] 69 247 .. 68 247 .. 0.90 Alignments for each domain: == domain 1 score: 172.7 bits; conditional E-value: 1.4e-53 -------------------------------.----------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaek.lkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 wgd+fl+ +gs f ++l +e+e +k++vr++l+++ +k+ ek++li+ L +LGi+yhFe eI+eiL++++ + XP_006299882.1 69 WGDHFLSVPLDGSKF-------DELSREIEVmMKPKVRDMLMSS----NKSDNEKIHLIHLLINLGIAYHFEAEIDEILSQAFLD 142 9*****777788866.......667777777569*******744....356669******************************* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLk 170 e++ ++e+ dlet++ +F ++R Gy + +d+F++Fk e+g+fkesl++d++g+++LYeA+hl+t++e+i++ealsFtr hL XP_006299882.1 143 VEDMIAKEH--DLETISTMFEVFRLRGYFMPCDAFNRFKGEDGRFKESLADDIRGMIQLYEAAHLGTPSEDIMDEALSFTRYHL- 224 999877766..*************************************************************************. PP -------.--------------- CS Terpene_synth_N-terminal 171 eslseel.sdespnlaeeVehaL 192 esl++++ + sp+l++++++aL XP_006299882.1 225 ESLTGQHaASDSPHLSKHIQNAL 247 77777774557779*******98 PP >> XP_006299223.1 hypothetical protein CARUB_v10015372mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 171.2 0.5 4e-53 3.1e-50 2 192 .] 76 252 .. 75 252 .. 0.91 Alignments for each domain: == domain 1 score: 171.2 bits; conditional E-value: 4e-53 -------------------------------.----------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaek.lkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 wgd+fl s+ ++l + eale+e+e +k++vr++l+ +p+ ++ +++li+ L +LG +++Fe+eI+eiL++++r+ XP_006299223.1 76 WGDHFL-SVPVNDL------EFEALEQEIESvMKPKVRDMLM-TPH---SNDTVRIRLIHLLISLGTAHYFESEIEEILQQAFRK 149 9****9.6777774......3499999999978********6.544...66679******************************* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLk 170 + s+e ddlet+A++F +LR +G+++ +dvF++Fk e+g+fkesl++d++g+l+LYeAshl+t +e+i+eeal+Ftr hL+ XP_006299223.1 150 LDGLISKE--DDLETIAIMFEVLRLYGHKMPCDVFDRFKGEDGKFKESLAKDTRGMLQLYEASHLGTLSEDIMEEALTFTRYHLE 232 99866555..4*************************************************************************9 PP ---------------------- CS Terpene_synth_N-terminal 171 eslseelsdespnlaeeVehaL 192 esl+++ +s+nl ++Ve+aL XP_006299223.1 233 ESLTNQG--TSSNLLKHVENAL 252 9999775..4557*******98 PP >> XP_006304837.1 hypothetical protein CARUB_v10012518mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.6 0.4 1.3e-52 9.7e-50 2 192 .] 83 265 .. 82 265 .. 0.89 Alignments for each domain: == domain 1 score: 169.6 bits; conditional E-value: 1.3e-52 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wg++fl s + + ++ +al+ e+e+lk++vr++++ +++ ++++++++ +i L +LG++yhFe+eI+e+L++ +r++ XP_006304837.1 83 WGNQFL-SAHVDL------SEMDALRIEIETLKPKVRDMFMLSSEGMKSTKKKNIMFIYLLVSLGLAYHFEDEIEETLRDGFRKM 160 999999.444443......35599999**************7777777888899******************************9 PP ---.--------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eek.kseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLk 170 ee+ + + e+ddl+tv++ Fr++R++G+++ssdvF++F+ ++g+fke+l++d kg+lsLYeA++++t++++iL+ealsF+ ++ XP_006304837.1 161 EEEdMMSGEDDDLYTVSILFRVFRTYGHNISSDVFRRFQGDNGKFKECLAKDPKGILSLYEAANMATTNDYILDEALSFALSYF- 244 99875555566*************************************************************************. PP ---------------------- CS Terpene_synth_N-terminal 171 eslseelsdespnlaeeVehaL 192 esl+ ++ +++p+l++++++aL XP_006304837.1 245 ESLHASE-TSKPDLSRRIRYAL 265 7666554.44568*******98 PP >> XP_006279831.1 hypothetical protein CARUB_v10028174mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.5 0.7 1.3e-52 1e-49 2 192 .] 23 203 .. 22 203 .. 0.90 2 ? -1.8 0.1 4.2 3.3e+03 22 40 .. 482 500 .. 461 520 .. 0.48 Alignments for each domain: == domain 1 score: 169.5 bits; conditional E-value: 1.3e-52 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wgd+fl+ k +s + + le+e+e lk++vr+ + +++ ++ ++++++ i+ L +LG+syhFe+eI+e+++++++++ XP_006279831.1 23 WGDQFLKFSKADS-------DFDVLEREIEVLKPKVRENIFMLSSRDKDATKKTIHSIHLLISLGLSYHFENEIEETMKHAFEKI 100 9999995444444.......4499************99888777778888889******************************** PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 e+ ++e+ dl+t++++Fr++R++G+++ sdvF++Fk ++g+fke+l +dvkg+lsLYeA h++t++++iL+ea sFt +hL e XP_006279831.1 101 EDLLADEN--DLYTISIMFRVFRTYGHNMLSDVFNRFKGNDGKFKETLLQDVKGMLSLYEAVHFGTTTDHILDEASSFTLNHL-E 182 *9765554..*************************************************************************.7 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 l++ +++++p++++ +++aL XP_006279831.1 183 PLATGRKSCPPHISKLIRNAL 203 55656556777********98 PP == domain 2 score: -1.8 bits; conditional E-value: 4.2 ------------------- CS Terpene_synth_N-terminal 22 taealeeeaeklkeevrkl 40 t+e+ +e+ek+ +++k+ XP_006279831.1 482 TKEEASRELEKVVRDMNKI 500 2222222333332333333 PP >> XP_006286118.1 hypothetical protein CARUB_v10007667mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 165.8 0.6 1.8e-51 1.4e-48 2 192 .] 23 201 .. 22 201 .. 0.89 2 ? 5.7 0.2 0.022 17 64 101 .. 200 230 .. 199 244 .. 0.69 Alignments for each domain: == domain 1 score: 165.8 bits; conditional E-value: 1.8e-51 ----------------------------------------------------.-------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdle.ekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 w d+fl+ + ++l + + + e+e++k++v+++l + ++ + d+ +k li + +LG++yhFe+eI+eiL++++++ XP_006286118.1 23 WADHFLY-VPVDEL------ELDVIASELEAIKPKVKDILISHSQANGHDSAkRKTLLIYLMTSLGVAYHFENEIEEILTHAFEK 100 7777774.444442......3477888999**********966666666666599****************************** PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLk 170 ++++ +e+ dl+t+++ F+++R++G+++ssdvFk+Fk e+g+f sl++d+kg+lsLYeAshl+t+++ iL+ealsFt++hL XP_006286118.1 101 IDDMIVDEH--DLYTISISFWVFRTYGHNMSSDVFKRFKGEDGEFMDSLTKDAKGMLSLYEASHLRTTKDCILDEALSFTTRHL- 182 **9876666..*************************************************************************. PP ---------------------- CS Terpene_synth_N-terminal 171 eslseelsdespnlaeeVehaL 192 esl+++ esp+l++ +++aL XP_006286118.1 183 ESLAGR---ESPHLSRLIHNAL 201 888865...5789*****9998 PP == domain 2 score: 5.7 bits; conditional E-value: 0.022 -------------------------------------- CS Terpene_synth_N-terminal 64 rLGisyhFeeeIkeiLdeiyrsweekkseeeeddletv 101 LG+s+h++ eI +L++i + +e+ d +++ XP_006286118.1 200 ALGLSQHWNMEILVALEYISFYKHEE-------DHDET 230 59*****************9665442.......22333 PP >> XP_006279816.1 hypothetical protein CARUB_v10028094mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.7 0.6 4.8e-52 3.8e-49 2 192 .] 23 203 .. 22 203 .. 0.91 Alignments for each domain: == domain 1 score: 167.7 bits; conditional E-value: 4.8e-52 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wgd+fl k +s f + le+e+e lk++vr+ + + +++ ++ ++++++ ++ L +LG+syhFe+eI+e+L+++++++ XP_006279816.1 23 WGDQFLMISKADSDF-------DVLEREIEVLKPKVRENIFTLSSRDQDATKKTIHSVHLLISLGLSYHFEKEIEETLKHAFEKI 100 999999766666644.......99*************999988888888888********************************* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 e+ ++e+ dl+t++++Fr++R++G+++ sdvF++Fk ++g+fke+l++dvkg+lsLYeA h++t++++iL+ea sF +hL e XP_006279816.1 101 EDLLADEN--DLYTISIMFRVFRTYGHNMLSDVFSRFKGKDGKFKETLMQDVKGMLSLYEAVHFGTTTDHILDEASSFILSHL-E 182 *9765554..*************************************************************************.7 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 sl++ ++++p++++ +++aL XP_006279816.1 183 SLATGGRSCPPHISKLIRNAL 203 77766666777********98 PP >> XP_006285692.1 hypothetical protein CARUB_v10007162mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 162.9 0.1 1.4e-50 1.1e-47 2 192 .] 72 249 .. 71 249 .. 0.88 Alignments for each domain: == domain 1 score: 162.9 bits; conditional E-value: 1.4e-50 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 w+++f s+ + ++ +al +e+++lk++v+++++++ ++++++++++ +i +LGi++hFeeeI e+L+e ++++ XP_006285692.1 72 WTHYFH-SIPLDV------SEMDALNKEIDALKPKVKNIFMSS--QSSDSTKKRILIIYLFVSLGIAHHFEEEIYETLNEGFKEI 147 666665.444443......34599999*************755..45677779******************************** PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 e++++ ee dl+ v+ F+++R G+++ssdvF +Fk ++gnfkesl ed+kg+lsLYeAshl+t++++iL+eal Ft++hL++ XP_006285692.1 148 EKMMAGEE--DLYIVSTIFWVFRRFGHYISSDVFTRFKGSNGNFKESLIEDTKGMLSLYEASHLATTKDYILDEALIFTSSHLES 230 *9876655..*************************************************************************55 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 ++++ +++p+l +V++aL XP_006285692.1 231 LVASG--TCPPHLLVRVRNAL 249 55543..4666*******998 PP >> XP_006300014.1 hypothetical protein CARUB_v10016237mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 162.7 0.3 1.7e-50 1.3e-47 2 192 .] 73 250 .. 72 250 .. 0.90 Alignments for each domain: == domain 1 score: 162.7 bits; conditional E-value: 1.7e-50 ----------------------.-------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsata.ealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 wgd+fl s++ + t+ ++le+e+e++k+ vr++l + ++++ +ek++li+ L +LGisyhF+ +I+eiL++ +++ XP_006300014.1 73 WGDHFL-SVSHDR-------TEfDELEREIETMKPLVRDMLV--S--SQSSDKEKIRLIHLLVSLGISYHFDMDIQEILKQSFKK 145 *****9.666666.......55599****************4..3..2467779******************************* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLk 170 ++ + e+ dlet++++F ++R +G+++s+d+F+kF+ e+g+fkesl++dv+gll+++e +hl+t++e+i++ealsFtr+hL XP_006300014.1 146 LDDIMVGED--DLETISIMFEVFRLYGHKMSCDAFDKFRGEDGKFKESLARDVRGLLQFFEVAHLGTPTEDIMDEALSFTRNHL- 227 998765554..*************************************************************************. PP -------.--------------- CS Terpene_synth_N-terminal 171 eslseel.sdespnlaeeVehaL 192 es ++ + s ++p+l ++++++L XP_006300014.1 228 ESWAGGNvSGATPHLFKHIKNSL 250 77777763558889******987 PP >> XP_006295697.1 hypothetical protein CARUB_v10024815mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 161.8 0.0 3.1e-50 2.4e-47 2 192 .] 45 221 .. 44 221 .. 0.89 2 ? -2.9 0.0 9.2 7.1e+03 18 41 .. 497 520 .. 486 534 .. 0.62 Alignments for each domain: == domain 1 score: 161.8 bits; conditional E-value: 3.1e-50 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wgd+fl +l + ++ +a+++e++++k++ rk+l+ +++ +++++++ i L LG++yhFe+eI++ L++ ++++ XP_006295697.1 45 WGDHFL-RLPINV------SEMDAVTREMNAIKPTARKMLMYSQD--VEETKKRILTIYLLVALGLAYHFEDEIDDNLKHSFENM 120 999999.455554......35589999*************85543..4566699******************************9 PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 e+ ++ e+ dl tv++ F+++R++Gy+ ssdvFk+Fk e+g+fke+l+ed+kgll+LYeA++l+t++++iL+ea+ F+++hL e XP_006295697.1 121 ETVMAGET--DLSTVSVIFWVFRTYGYNLSSDVFKRFKGEDGKFKECLKEDAKGLLNLYEATQLGTTTDDILDEAMIFASSHL-E 202 98776655..*************************************************************************.6 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 +l + + ++p++++ +++aL XP_006295697.1 203 RLVGGT--CPPHISRVIRNAL 221 666553..6779******998 PP == domain 2 score: -2.9 bits; conditional E-value: 9.2 ------------------------ CS Terpene_synth_N-terminal 18 spsataealeeeaeklkeevrkll 41 ++++t +a+ + +++l++ v++ l XP_006295697.1 497 TEEETYKAFHKMVRDLEKSVNTEL 520 445555677777777777776554 PP >> XP_006282404.1 hypothetical protein CARUB_v100281680mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 160.7 0.9 6.7e-50 5.2e-47 2 191 .. 23 202 .. 22 203 .. 0.89 Alignments for each domain: == domain 1 score: 160.7 bits; conditional E-value: 6.7e-50 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wgd+fl+ k +s + + le+e+e lk++vr+ + ++ +++++++++ i L++LG++yhF++eI++ L+++++++ XP_006282404.1 23 WGDQFLKFSKADS-------DFDVLEREIEVLKPKVRENIFMLSSKDKDTTKRTIHSIYLLESLGLAYHFDKEIEDSLKHAFEKI 100 9999995444444.......4499************998876666677777799******************************* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 e+ ++e ddl+t++++Fr++R++ +++ sdvF++Fk ++g+fke+l +dvkg+lsLYeA +++t++++iL+ea sFt +hL e XP_006282404.1 101 EDLIADE--DDLYTISIMFRVFRTYCHNMLSDVFNRFKGKDGKFKETLIQDVKGILSLYEAVQFGTTTDHILDEASSFTLNHL-E 182 9976554..5*************************************************************************.7 PP -------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVeha 191 l++ ++++sp++ + +++a XP_006282404.1 183 PLATGRKSCSPHILKLIRNA 202 56656567888999999987 PP >> XP_006287438.1 hypothetical protein CARUB_v10000642mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 158.0 0.2 4.4e-49 3.4e-46 11 192 .] 25 193 .. 16 193 .. 0.87 Alignments for each domain: == domain 1 score: 158.0 bits; conditional E-value: 4.4e-49 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 11 kngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsweekkseeee 95 ++++ +++++e+ +l+e v++ ++++ + + e++++id+L rLG+syhFe++I e Ld+++++ + ++ +++ XP_006287438.1 25 SKSD------LGNDKFQEKHATLREVVKESFMSS----KANPIENIKFIDALCRLGVSYHFERDIVEKLDKLFDCLDFNHMIRQD 99 3333......245889999999*99999999644....46888********************************9988555544 PP -.----------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 96 d.dletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLkeslseelsd 179 dl+tv + F+++Rq G++ s dvF+kFkde+g+fk +l d++g+lsLYeA++ st+ge+i++eal+F+++hLke++s + XP_006287438.1 100 GcDLYTVGILFQVFRQFGFKLSADVFEKFKDENGKFKGELVADANGMLSLYEAAQWSTHGEDIIDEALAFSSSHLKELSS-R--- 180 48*************************************************************************77544.3... PP ------------- CS Terpene_synth_N-terminal 180 espnlaeeVehaL 192 +sp+la+++++aL XP_006287438.1 181 SSPHLATRIKNAL 193 4678*******98 PP >> XP_006300940.1 hypothetical protein CARUB_v10021320mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.4 0.0 6.6e-49 5.1e-46 2 192 .] 61 239 .. 60 239 .. 0.90 Alignments for each domain: == domain 1 score: 157.4 bits; conditional E-value: 6.6e-49 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wg++fl ++ + l + +al +e+++lk +v+++l pa k++++++ ++ L +LG++ hF +eI+e L++ +++ XP_006300940.1 61 WGHHFL-TVPVDLL------EMNALAREIDELKIKVKEMLI-KPALGIKETKKRIMFVYLLVSLGLAGHFVDEINENLKQGFEAR 137 999999.5666663......4689999*************6.5666778888********************************9 PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 ee+++ e+ dl+tv+ F+++R++Gyd+ssdvFk+F+ e+g+fke+l d+kg+lsLYeA+hl t++e+iL+eal+Ft +L e XP_006300940.1 138 EEMMAGED--DLYTVSTIFWIFRTYGYDMSSDVFKRFQREDGTFKECLVADAKGMLSLYEAAHLETQTEKILDEALRFTPGQL-E 219 99876655..*************************************************************************.8 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 +l+e + +p++++ ++++L XP_006300940.1 220 LLAEGG-NLPPHISRLIKNSL 239 788665.44569999999877 PP >> XP_006289905.1 hypothetical protein CARUB_v10003521mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.0 0.5 9e-49 7e-46 2 192 .] 68 245 .. 67 245 .. 0.89 Alignments for each domain: == domain 1 score: 157.0 bits; conditional E-value: 9e-49 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 w+ +fl s++ ++ ++ + l++e+e+lk++vr +l +++ ++ +++++ li +L +LG++ hFe+eIke L+e ++s+ XP_006289905.1 68 WTSHFL-SVSVDN------SEMDVLRREIEALKPKVRGMLL--SSQGREAKKKRILLIYQLVSLGLAWHFEDEIKESLEESFKSI 143 889998.566555......34599****************5..4445677779******************************** PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 +++ e+ dl++v++ F+++R++G+++ssdvFk+F+ ++g+fke+l ed+kg+l LYeA++++t+++++++ea+sF+++hL e XP_006289905.1 144 ADMMVGEY--DLYNVSIIFWVFRTYGHNMSSDVFKRFQGDDGKFKEHLIEDIKGILALYEAANMGTKTDYVMDEAISFATTHL-E 225 *9877766..*************************************************************************.6 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 s+s + +s+++++++++aL XP_006289905.1 226 SFSIGK-MCSSHFKTRIQNAL 245 555443.35558999999998 PP >> XP_006281945.1 hypothetical protein CARUB_v10028157mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.2 0.2 7.7e-49 6e-46 2 192 .] 23 203 .. 22 203 .. 0.89 2 ? -2.4 0.0 6.4 5e+03 20 42 .. 480 502 .. 467 517 .. 0.65 Alignments for each domain: == domain 1 score: 157.2 bits; conditional E-value: 7.7e-49 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wgd+fl +++ +l + + le+e+e lk++vr+ + +++ ++ +++k+ i+ L++LG+syhF++eI++ L+++++++ XP_006281945.1 23 WGDYFL-RVSITDL------DFDVLEREIELLKPKVRENIFILSSSDKDATKRKILSIHFLESLGLSYHFDKEIEDSLKHAFENI 100 999999.4555553......3599************9999866666777778********************************* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 e+ ++e+ dl+ ++++Fr++R++G+++ sdvF++Fk ++g+fke+l +dvkg+lsLYeA h++t++++i +ea sFt + L e XP_006281945.1 101 EDLIADEN--DLYIISIMFRVFRTYGHNMLSDVFNRFKGSDGKFKETLIQDVKGMLSLYEAVHFGTTTDHIFDEASSFTLNNL-E 182 *9776554..*************************************************************************.7 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 l++ +++++p++++ +++aL XP_006281945.1 183 PLATGRRSCPPHISKLIRNAL 203 56656556777********98 PP == domain 2 score: -2.4 bits; conditional E-value: 6.4 ----------------------- CS Terpene_synth_N-terminal 20 sataealeeeaeklkeevrkllk 42 t+++ +e+ek++e+++k+++ XP_006281945.1 480 GLTKDEASRELEKMNEDMNKIIN 502 34555566688888888888886 PP >> XP_006282975.1 hypothetical protein CARUB_v100067221mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 156.2 0.1 1.6e-48 1.3e-45 2 192 .] 22 199 .. 21 199 .. 0.89 Alignments for each domain: == domain 1 score: 156.2 bits; conditional E-value: 1.6e-48 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 w+d+f+ s ++ ++ +a+++e++ lk+evr+ll+ ++ ++++++k+ li+ L +LG++ hFe+eI++iL+++++ + XP_006282975.1 22 WTDYFV-SFPIDD------SELDAITREIDILKPEVRELLS--SQGDNETSKSKVLLIQLLLSLGLAFHFENEIENILEDVFQRI 97 888888.555555......34599999*************4..5666777889******************************** PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 e++ ++e +dl tv+++F ++R++G++ ss+vFk+F ++g+f++sl d+kg+++LYeA+hl+t+++++L+eal+Ft++hLk+ XP_006282975.1 98 EDMFGDE--RDLSTVSIMFCVFRTYGHNLSSNVFKRFIGDDGKFEKSLIGDTKGIMNLYEAAHLGTTKDYVLDEALKFTSNHLKS 180 *986554..4*************************************************************************88 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 +l++ + ++p++++ +++ L XP_006282975.1 181 LLAGGT--CQPHITKLIRNML 199 888664..6779999998876 PP >> XP_006304904.1 hypothetical protein CARUB_v100116241mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 156.4 1.3 1.4e-48 1e-45 2 192 .] 71 248 .. 70 248 .. 0.88 Alignments for each domain: == domain 1 score: 156.4 bits; conditional E-value: 1.4e-48 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wgd+fl s++ + + + ++ e+e+e++k+ vr++l+++ + + +ek++li+ L +LGisyhF++eI+eiL++ +++ XP_006304904.1 71 WGDHFL-SVSLDRA------EFDEQEREIEAMKPLVRDMLMSS----HGSDKEKIRLIHLLISLGISYHFDKEIQEILKQSFTKL 144 9****9.6666552......336666799999999*****744....367889*******************************9 PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 ++ e+ dlet++++F ++R +G+++s+d++ +F+ e+g+fkesl++dv+gll+L+e +hl+t +e+i++ea+sFtr+hL++ XP_006304904.1 145 DDLIVGED--DLETISIMFEVFRLYGHKMSCDALYRFRGEDGRFKESLARDVRGLLQLFEVAHLGTFSEDIMDEAMSFTRNHLES 227 98765554..*************************************************************************66 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 + ++ s+e+++l+++++++L XP_006304904.1 228 WVYGNVSSETTHLSKHIQNSL 248 666665666669******987 PP >> XP_006304827.1 hypothetical protein CARUB_v10012477mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 155.2 1.3 3.2e-48 2.5e-45 4 192 .] 73 247 .. 70 247 .. 0.86 Alignments for each domain: == domain 1 score: 155.2 bits; conditional E-value: 3.2e-48 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 4 dvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrswee 88 d fl+ kn+s + e+l +++e lk +v++ l + d + k++li+ L +LG++yhFe++I+e+L++++++ e+ XP_006304827.1 73 DRFLSLSKNDS-------EMESLGRNIEVLKARVSDKLV---C---LDAKGKIHLIHMLVSLGVAYHFEKQIEEFLKDAFEKVEN 144 55553333333.......44889999********88883...3...8999********************************999 PP -----------------------------------------------------------------------------------.- CS Terpene_synth_N-terminal 89 kkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke.s 172 + e +d++ +++ Fr++R +G++ ssdvF++Fk+e+g+fk++l +dv+g+ls+YeAsh++t++eeiL+ea++Ft+khL e + XP_006304827.1 145 ITIGE--EDIYSISVIFRVFRLYGHKLSSDVFNRFKEENGDFKKCLIDDVRGILSFYEASHFGTNTEEILDEAMQFTHKHL-ElY 226 64333..4*************************************************************************.636 PP ----------.---------- CS Terpene_synth_N-terminal 173 lseelsdesp.nlaeeVehaL 192 + + ++ ++ +++e +++ L XP_006304827.1 227 VGGGTNADNEaHISELIRNVL 247 665555566668999998876 PP >> XP_006301661.1 hypothetical protein CARUB_v10022111mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 153.0 0.0 1.6e-47 1.2e-44 2 192 .] 64 242 .. 63 242 .. 0.89 Alignments for each domain: == domain 1 score: 153.0 bits; conditional E-value: 1.6e-47 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 wg++fl ++ + ++ + l +e+++lk++v+ +l +pa+ k++++++ ++ L +LG++ hF +eI+e L++ +++ XP_006301661.1 64 WGHHFL-TVPIDL------SEMNVLAREIDELKKKVKGMLI-MPAQGIKETKKRIMFVYLLVSLGLACHFVDEINENLKQGFEAR 140 899998.454444......34588999*************5.7777778888*******************************99 PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 87 eekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLke 171 ee + e+ dl+tv+ F+++R++Gyd+ssdvFk+F+ e+g+fke++ d+kg+lsLYeA+h t+ e+iL+eal+Ft +L e XP_006301661.1 141 EELIAGED--DLYTVSTIFWIFRTYGYDMSSDVFKRFQREDGTFKECIVGDAKGMLSLYEAAHWETQIEKILDEALRFTPGQL-E 222 98766554..*************************************************************************.8 PP --------------------- CS Terpene_synth_N-terminal 172 slseelsdespnlaeeVehaL 192 +l+e + +p++++ ++++L XP_006301661.1 223 LLAEGG-NLPPHISRLIKNSL 242 788665.44569999999877 PP >> XP_006281703.1 hypothetical protein CARUB_v10027853mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 153.3 0.6 1.3e-47 9.8e-45 26 192 .] 5 165 .. 1 165 [. 0.89 Alignments for each domain: == domain 1 score: 153.3 bits; conditional E-value: 1.3e-47 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 26 leeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsweekkseeeeddletvAlaFrLLRq 110 l +e+e lk+ vr+ + + ++ +++k+ i+ L +LG+syhF++eI+e+L+++++ ++e ++e dl+t++++Fr+LR+ XP_006281703.1 5 LAREIEVLKPIVRDDIFT---LSSYAIKKKILSIHLLISLGLSYHFQNEIEETLKHAFERIDELVTDE--TDLYTISIMFRVLRT 84 6789999*9999988854...44578999*******************************99965444..4************** PP ---------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 111 hGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLkeslseelsdespnlaeeVehaL 192 +G+++ sdvF++Fk+++g+fke+l +dvkg+ls+YeA h++t++++iL+ea sFt +hL+ +++ ++ ++pn+ + +++aL XP_006281703.1 85 YGHNMLSDVFSRFKENNGKFKECLIKDVKGMLSFYEAVHFGTTNDHILDEASSFTLEHLEPLAMCQR-AIPPNMLKLIQKAL 165 ***********************************************************55666553.45559*****9998 PP >> XP_006292580.1 hypothetical protein CARUB_v10018817mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 151.5 0.7 4.4e-47 3.4e-44 24 192 .] 42 205 .. 26 205 .. 0.86 Alignments for each domain: == domain 1 score: 151.5 bits; conditional E-value: 4.4e-47 ------------------------------------------------------------------.------------------ CS Terpene_synth_N-terminal 24 ealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsweek.kseeeeddletvAlaFrL 107 e+ +e++ lke+v++ ++a+ +++ e+++lid+L rLGisyhFe+eI L++i+ s++ + + ++e++l+tv l F++ XP_006292580.1 42 EKNKEKLLSLKEKVMESFMAS----RQNPIENIKLIDALCRLGISYHFEREIFMQLETIFGSHDFMqMIIDNESSLYTVGLVFQI 122 455566777*********755....36888*******************************9988854445555*********** PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 108 LRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLkeslseelsdespnlaeeVehaL 192 +Rq Gy+ + dvF+kFk+++g+f+ +l+ed+kg+l LYeA+h st+ge++L+eal+F+r+ L+e +s ++s +++l+ ++++aL XP_006292580.1 123 FRQFGYKFTTDVFEKFKNKDGKFEDCLAEDAKGVLCLYEAAHWSTHGEDMLDEALTFSRSILEEIAS-RSS-DPHHLTVRIKNAL 205 **************************************************************66544.432.3448******998 PP >> XP_006300764.1 hypothetical protein CARUB_v10019830mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.0 2.5 2e+03 19 44 .. 25 49 .. 12 61 .. 0.66 2 ! 146.5 0.0 1.5e-45 1.1e-42 1 192 [] 213 411 .. 213 411 .. 0.89 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 2.5 -------------------------- CS Terpene_synth_N-terminal 19 psataealeeeaeklkeevrkllkav 44 +t ++ + +e+ ke++rk+l +v XP_006300764.1 25 VDQTRANNV-SFEQAKEKIRKMLVNV 49 444454444.6888999****99744 PP == domain 2 score: 146.5 bits; conditional E-value: 1.5e-45 --------------------------------......----------....--------------------------------- CS Terpene_synth_N-terminal 1 dwgdvfllslkngslfnspsataealeeeaek......lkeevrkllk....avpavypkdleekLelidtLqrLGisyhFeeeI 75 dw+ ++++++kngslf+sp++ta+a++ ++++ l +ll+ avp+vyp+d++++L++id+L++LGi+++F++eI XP_006300764.1 213 DWNSIVKYQRKNGSLFDSPATTAAAFT-QFGNdgclryL----CSLLQkfeaAVPTVYPSDQYARLRIIDALESLGIDRYFKNEI 292 7**************************.77777*95553....67777777899******************************* PP ---------------------...-----------------------------------------...----------------- CS Terpene_synth_N-terminal 76 keiLdeiyrsweekkseeeed...dletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsed...vkgllsLYeAshlsteg 154 k++Lde+yr+w + + e+ dl t+Al FrLL hGydvs d +k F++e+g f+ +l+ + ++l+L++As+ s++ XP_006300764.1 293 KSLLDETYRYWLRGD----EEiclDLITCALTFRLLLAHGYDVSYDPLKPFAEESG-FSDTLEGYlknTFSVLELFKASQ-SYPH 371 ************953....22356******************************99.98888744566999********9.8999 PP -------------------------.---.---------- CS Terpene_synth_N-terminal 155 eeiLeealsFtrkhLkeslseelsd.esp.nlaeeVehaL 192 e+ L++ s+++++L+ +ls++l++ + l++eVe aL XP_006300764.1 372 ESALKKQCSWSKQYLEMELSNRLKTsVRDkYLKKEVEDAL 411 ***************8899988855455557******998 PP >> XP_006293887.1 hypothetical protein CARUB_v10022874mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 147.1 0.9 9.4e-46 7.3e-43 2 192 .] 56 231 .. 55 231 .. 0.85 2 ? -0.9 0.1 2.4 1.8e+03 31 67 .. 512 557 .. 488 562 .. 0.55 Alignments for each domain: == domain 1 score: 147.1 bits; conditional E-value: 9.4e-46 ----------------------------------------------------.-------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdle.ekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 w++ lls+kn+++ +a+ +ee + lke+vrk+l +k+++ e+Lelid+Lq+LG+syhFe+eI++iL+ y++ XP_006293887.1 56 WDHSDLLSIKNKYA------KAK-RVEERDLLKEKVRKMLG-----DEKKTYiEQLELIDDLQKLGVSYHFEREIENILTVSYQK 128 77877888888883......344.4448889*********3.....3466666******************************99 PP ------------------------------------------------------------------------------.------ CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeeals.FtrkhL 169 + + ++dl ++Al+FrL+RqhG++vs+ vF+ F+++ g+f++ +d+ gl+sLYeAs+lst+ +++L++ ++ F+++ L XP_006293887.1 129 DRINI----RKDLRATALEFRLFRQHGFNVSEGVFDVFMENCGEFES---DDIGGLISLYEASYLSTKWDTKLQQFIRpFATQKL 206 76633....45********************************9977...99***********************9988****** PP --------.--.---.---------- CS Terpene_synth_N-terminal 170 keslseel.sd.esp.nlaeeVehaL 192 ++ ++++ +d + ++ ++V +aL XP_006293887.1 207 RDIVDTQCdKDfG-ScDIVDMVVQAL 231 9888877644442.336888887776 PP == domain 2 score: -0.9 bits; conditional E-value: 2.4 ------------.........------------------------- CS Terpene_synth_N-terminal 31 eklkeevrkllk.........avpavypkdleekLelidtLqrLGi 67 ek + +vr++++ ++++ ++ ++ +e + +L r+ + XP_006293887.1 512 EKARSHVRQMINdlwdemnyeKMSHGSSLHHHDFMETVMNLARMSL 557 2244455555555555554443444444455566777877777765 PP >> XP_006293874.1 hypothetical protein CARUB_v10022869mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 143.2 4.0 1.5e-44 1.2e-41 2 179 .. 56 218 .. 55 235 .. 0.86 Alignments for each domain: == domain 1 score: 143.2 bits; conditional E-value: 1.5e-44 ----------------------------------------------------.-------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdle.ekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 w+++ llsl+n++ +++ ++e + lke+vrk++ +k+++ ekLe+id+++rLGisyhF+ eI++iL + y++ XP_006293874.1 56 WDHHHLLSLENQY-------AKDKSMRERDLLKEKVRKMFD-----DEKKTYlEKLEFIDDVERLGISYHFQAEIDNILLSSYQK 128 *************.......4477777999**********4.....3455556******************************99 PP ------------------------------------------------------------------------------.------ CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeeals.FtrkhL 169 + + +e dl+++Al+FrL+RqhG++vs+d+F+ F+ ++++f++ +d+++ +sLYeAs+lst+ +++L++ ++ F+++ L XP_006293874.1 129 DRV-NVKEC--DLHATALEFRLFRQHGFNVSEDIFDVFMANSEKFES--GTDINAFISLYEASYLSTKLDSKLQKFIRpFAKQKL 208 776.33333..********************************7744..689***********************9988****** PP ---------- CS Terpene_synth_N-terminal 170 keslseelsd 179 ++ l+++ s+ XP_006293874.1 209 RDFLDNNGSS 218 9988877533 PP >> XP_006283443.1 hypothetical protein CARUB_v10004490mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 136.1 1.0 2.2e-42 1.7e-39 25 192 .] 49 209 .. 28 209 .. 0.87 Alignments for each domain: == domain 1 score: 136.1 bits; conditional E-value: 2.2e-42 ------------------------------------------------------------------------....--------- CS Terpene_synth_N-terminal 25 aleeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsweekkseeeed....dletvAlaF 105 +++ +a+ l ++v+k+l++ ++ l e+Lel+d LqrLG+sy Fe eIk+iL++++r++ + ++++ ++ dl+++Al+F XP_006283443.1 49 TYV-RAKLLTNQVSKMLNE-----TEGLPEQLELVDILQRLGVSYNFEGEIKKILTNVHRKNVRADKSQMDQkrweDLYATALEF 127 445.777899*******53.....36677********************************999855555446899********* PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 106 rLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLkeslseelsdespnlaeeVeh 190 rLLRqhG+d+ +dvF++ +g + ed+k++lsLYeAs+lst+ +++L+e + Ft++ ++ +++++++++p ++++V h XP_006283443.1 128 RLLRQHGFDIAQDVFDRTYG-DG----LDDEDFKSILSLYEASYLSTRFDTKLKETIYFTTERHRNFVKRKKTETKPYVRKMVIH 207 *****************984.66....3459*********************************99999887666779******* PP -- CS Terpene_synth_N-terminal 191 aL 192 aL XP_006283443.1 208 AL 209 98 PP >> XP_006283392.1 hypothetical protein CARUB_v10004436mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 136.0 5.2 2.5e-42 1.9e-39 2 192 .] 54 229 .. 53 229 .. 0.84 Alignments for each domain: == domain 1 score: 136.0 bits; conditional E-value: 2.5e-42 -------------------------------.----------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaek.lkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 w++++llsl n +++ + +++e+a+k lkeevrk l ++ +++ e+Le+id+LqrLGisyh+++eI++iL++i+++ XP_006283392.1 54 WDHQYLLSLDNIYVK------EVETKEKANKlLKEEVRKKLGEI----DQSSIEQLEMIDSLQRLGISYHYKQEIHDILKNIHDQ 128 999999999999953......433444555559********544....35666******************************88 PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLk 170 e + ++++l+F LLRqhG+dvs+d F+ Fk e e+l +d+kg lsLYeAs++st ++ +L+ea+ ++++ L+ XP_006283392.1 129 RGE-I------ERDATSLEFFLLRQHGFDVSQDDFDVFKSEIR---ETLGSDIKGFLSLYEASYFSTDSDFKLKEARLYASERLS 203 665.2......5689************************7666...9999**********************************9 PP ---------...---.---------- CS Terpene_synth_N-terminal 171 eslseelsd...esp.nlaeeVehaL 192 e ++e+++ e + + e+V++aL XP_006283392.1 204 EFVAENSKIsfrEDEaYMLEMVKRAL 229 98888773335433445889999887 PP >> XP_006292532.1 hypothetical protein CARUB_v10018762mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 136.4 2.4 1.9e-42 1.5e-39 2 192 .] 55 233 .. 54 233 .. 0.85 Alignments for each domain: == domain 1 score: 136.4 bits; conditional E-value: 1.9e-42 ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 w++ +lls++n+++ ++ +++ + lk++v+++l v+ ++ e+Lelid+Lq+LG+syhFe eI++iL+++y ++ XP_006292532.1 55 WDHCYLLSIENKYA------SEREVV-TRDVLKKKVKRMLD-VT----QSRLEQLELIDDLQKLGVSYHFELEINNILTDFYLKN 127 99**********93......444455.6889*********4.53....5677******************************999 PP ---..----------------------------------------------.----------------------------.---- CS Terpene_synth_N-terminal 87 eek..kseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkesls.edvkgllsLYeAshlstegeeiLeeals.Ftrk 167 ++ k ++ed+l+++Al+FrLLRqhG+dvs+++F+ + d+ ++ ++++ e++++++sLYeAs lst+ +++L+++++ F++ XP_006292532.1 128 GRNvwK-CDKEDELHATALEFRLLRQHGFDVSENIFDVIIDKIES--NRFKiENITSIISLYEASFLSTKADTKLHKVIRpFATD 209 999743.34445*****************************7773..3444499***********************9999**** PP ------------------------- CS Terpene_synth_N-terminal 168 hLkeslseelsdespnlaeeVehaL 192 +++++++++s ++ +++e+ haL XP_006292532.1 210 EIRKYVDDDESYNM-EIREKAIHAL 233 **999998763333.5888888887 PP >> XP_006283393.1 hypothetical protein CARUB_v10004436mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 135.9 5.2 2.6e-42 2e-39 2 192 .] 54 229 .. 53 229 .. 0.84 2 ? -2.1 0.0 5.4 4.2e+03 105 129 .. 385 416 .. 382 427 .. 0.74 Alignments for each domain: == domain 1 score: 135.9 bits; conditional E-value: 2.6e-42 -------------------------------.----------------------------------------------------- CS Terpene_synth_N-terminal 2 wgdvfllslkngslfnspsataealeeeaek.lkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrs 85 w++++llsl n +++ + +++e+a+k lkeevrk l ++ +++ e+Le+id+LqrLGisyh+++eI++iL++i+++ XP_006283393.1 54 WDHQYLLSLDNIYVK------EVETKEKANKlLKEEVRKKLGEI----DQSSIEQLEMIDSLQRLGISYHYKQEIHDILKNIHDQ 128 999999999999953......433444555559********544....35666******************************88 PP ------------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 86 weekkseeeeddletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLk 170 e + ++++l+F LLRqhG+dvs+d F+ Fk e e+l +d+kg lsLYeAs++st ++ +L+ea+ ++++ L+ XP_006283393.1 129 RGE-I------ERDATSLEFFLLRQHGFDVSQDDFDVFKSEIR---ETLGSDIKGFLSLYEASYFSTDSDFKLKEARLYASERLS 203 665.2......5689************************7666...9999**********************************9 PP ---------...---.---------- CS Terpene_synth_N-terminal 171 eslseelsd...esp.nlaeeVehaL 192 e ++e+++ e + + e+V++aL XP_006283393.1 204 EFVAENSKIsfrEDEaYMLEMVKRAL 229 98888773335433445889999887 PP == domain 2 score: -2.1 bits; conditional E-value: 5.4 -------------.......------------ CS Terpene_synth_N-terminal 105 FrLLRqhGydvss.......dvFkkFkdeegn 129 + +LR +G +v + d Fk F e + XP_006283393.1 385 YDILRDKGLNVIPhlkqvwtDLFKTFLTEAKW 416 67899999998876666777888888877665 PP >> XP_006301761.1 hypothetical protein CARUB_v10022222mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 129.0 0.3 3.4e-40 2.7e-37 29 180 .. 70 215 .. 43 225 .. 0.78 Alignments for each domain: == domain 1 score: 129.0 bits; conditional E-value: 3.4e-40 ----.-------------------------------------------------------------------------------- CS Terpene_synth_N-terminal 29 eaek.lkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsweekkseeeeddletvAlaFrLLRqhG 112 +++ ++++++l + + +++L++id++q LGi+ hF++eI+++L+ iy++ ++ + dl++vAl+FrLLRq+G XP_006301761.1 70 YSHEfNIKKIKNILI--AN-IDDVPSANLDMIDAIQVLGIDLHFKREIEQTLHIIYKECTKFN----MYDLHEVALCFRLLRQEG 147 222242367788884..22.33444599****************************9877632....33**************** PP -------------------------------------------------------------------- CS Terpene_synth_N-terminal 113 ydvssdvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLkeslseelsde 180 ++v++++F+++ d++g fk++++ vkgl++LYeAs+l++egee+L+ +++Ft ++L e++s++ s++ XP_006301761.1 148 HYVQESIFENILDKKGGFKNDIKIYVKGLIELYEASELGVEGEETLDGVREFTFSCLGELCSGRVSHQ 215 ********************99999********************************99988765332 PP >> XP_006301504.1 hypothetical protein CARUB_v10021930mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 125.9 0.2 3e-39 2.3e-36 9 188 .. 214 408 .. 206 410 .. 0.84 Alignments for each domain: == domain 1 score: 125.9 bits; conditional E-value: 3e-39 ------------------------......---------------------.--------------------------------- CS Terpene_synth_N-terminal 9 slkngslfnspsataealeeeaek......lkeevrkllkavpavypkdle.ekLelidtLqrLGisyhFeeeIkeiLdeiyrsw 86 + ++gslf+ psata+a++ +++ lk v++ ++vp+vyp ++e kL +i+ + ++G+s++F eeI+++L +iy+s+ XP_006301504.1 214 DESDGSLFQLPSATAAAYML-SGNtkclayLKSLVQRCPHGVPQVYPLSEElIKLTMINVMDNFGLSEYFGEEINRFLLQIYKSH 297 6789***********99994.4444898888777777777***********99*******************************9 PP ----------......-----------------------------------------....------------------------ CS Terpene_synth_N-terminal 87 eekkseeeed......dletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsed....vkgllsLYeAshlstegeeiLeea 161 e+ + e+ +l++ +l+Fr+LR++Gydv + +F++F ++e+ ++ +l+++ + +ls+Y+A++l++++e +Leea XP_006301504.1 298 EKVDVEKM-AisskvdQLHKASLEFRMLRMNGYDVLPRSFCWFLNDEE-IRDHLERNieclFVVILSVYRATDLMFPKECELEEA 380 98743333.2467889****************************8777.8899998867766679******************** PP ----------.-----------.------ CS Terpene_synth_N-terminal 162 lsFtrkhLke.slseelsdesp.nlaeeV 188 ++F+rk+L++ +l ++ ++ ++ ++++e+ XP_006301504.1 381 REFSRKLLEKsQLIDD-NNVPSiHIKHEI 408 ********99555444.444555687777 PP >> XP_006300608.1 hypothetical protein CARUB_v10019776mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.0 6.1 4.7e+03 63 89 .. 162 188 .. 157 200 .. 0.76 2 ! 116.0 0.0 3.3e-36 2.6e-33 11 176 .. 229 409 .. 219 420 .. 0.83 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 6.1 --------------------------- CS Terpene_synth_N-terminal 63 qrLGisyhFeeeIkeiLdeiyrsweek 89 q+LG++ F++ e+++ ++ + +e XP_006300608.1 162 QKLGLHFVFSSRCIEMIKGMFYQRQEI 188 89*********9999999999776664 PP == domain 2 score: 116.0 bits; conditional E-value: 3.3e-36 ----------------------.....---------------------.------------------------------------ CS Terpene_synth_N-terminal 11 kngslfnspsataealeeeaek.....lkeevrkllkavpavypkdle.ekLelidtLqrLGisyhFeeeIkeiLdeiyrsweek 89 +gslf+spsata+a++ ++ l++ v+k ++vp+ yp ++ kL++++ ++++G+ + F +eI+ +L +iyr +++ XP_006300608.1 229 IDGSLFQSPSATASAFMLTRNTkclayLQNLVQKCPNGVPQKYPLNEDlIKLSMVNLIESIGLGEFFGSEIELVLGQIYRRRDKE 313 5899*********999844444888887777777777**********999******************************98875 PP -------.......-----------------------------------------....-------------------------- CS Terpene_synth_N-terminal 90 kseeeed.......dletvAlaFrLLRqhGydvssdvFkkFkdeegnfkeslsed....vkgllsLYeAshlstegeeiLeeals 163 ++ e+ + +l++ +laF++LR+hG d+s+ F++F ++++ + +l+++ + +ls+Y+A++l+++ge++Leea++ XP_006300608.1 314 EDVEK-KpmsyltdQLHKDSLAFQMLRMHGRDISPRRFCWFLKDQE-TRYHLERNidslLPVILSVYRATDLMFPGEHELEEARE 396 43333.368999999**************************86665.34455555455677899********************* PP ------------- CS Terpene_synth_N-terminal 164 FtrkhLkeslsee 176 +tr++L++s s + XP_006300608.1 397 YTRSLLEKSRSID 409 ******8865533 PP >> XP_006290473.1 hypothetical protein CARUB_v100190721mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.2 0.0 1.1e-23 8.6e-21 22 114 .. 36 128 .. 22 130 .. 0.81 Alignments for each domain: == domain 1 score: 75.2 bits; conditional E-value: 1.1e-23 --------------------------------------------------------------------..-------.------- CS Terpene_synth_N-terminal 22 taealeeeaeklkeevrkllkavpavypkdleekLelidtLqrLGisyhFeeeIkeiLdeiyrsweek..kseeeed.dletvAl 103 ++e+ ee++ lke+vr++l+a+++ + e++++idtL rLG+syhFe eI + L+++++++ + + ++++ dl+tv+l XP_006290473.1 36 DSESNEEKVSSLKETVREMLMASSK---EGPIENIKFIDTLCRLGVSYHFEGEIFSQLETMFSCHGFMqmMMIRDNEfDLYTVSL 117 34556779999*********86654...66669*******************************98765455555559******* PP ----------- CS Terpene_synth_N-terminal 104 aFrLLRqhGyd 114 F+++Rq Gy+ XP_006290473.1 118 VFQVFRQFGYK 128 **********8 PP >> XP_006301362.1 hypothetical protein CARUB_v10021772mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.2 0.1 4.5e-23 3.5e-20 119 192 .] 1 74 [. 1 74 [. 0.92 Alignments for each domain: == domain 1 score: 73.2 bits; conditional E-value: 4.5e-23 -------------------------------------------------------------------------- CS Terpene_synth_N-terminal 119 vFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLkeslseelsdespnlaeeVehaL 192 +F+kFk ++g+fk++l++dv+g+ls+YeAsh+++++e+iLeea+sFt+khL+ + +++ +++p+l++ ++ aL XP_006301362.1 1 IFNKFKGDDGDFKKCLTDDVRGMLSFYEASHFGITTEDILEEAMSFTQKHLELFVVGDKAKHHPHLTKLIQAAL 74 6**************************************************55777776667779*****9998 PP >> XP_006293315.1 hypothetical protein CARUB_v100190720mg, partial [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.4 0.0 1.3e-21 1e-18 119 192 .] 1 70 [. 1 70 [. 0.93 Alignments for each domain: == domain 1 score: 68.4 bits; conditional E-value: 1.3e-21 -------------------------------------------------------------------------- CS Terpene_synth_N-terminal 119 vFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhLkeslseelsdespnlaeeVehaL 192 vF kFk+++g+fke+l+ed+ gll LYeA+h st+ge+iL+eal F+r+hL e l+ + +sp++++++++aL XP_006293315.1 1 VFYKFKNKDGKFKEHLAEDAIGLLCLYEAAHWSTHGEDILDEALVFSRSHL-EGLTYQ---SSPHMSNRIKNAL 70 89*************************************************.766655...4678******998 PP >> XP_006301390.1 hypothetical protein CARUB_v10021803mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.6 0.0 6.5e-19 5.1e-16 118 169 .. 50 101 .. 46 115 .. 0.93 Alignments for each domain: == domain 1 score: 59.6 bits; conditional E-value: 6.5e-19 ---------------------------------------------------- CS Terpene_synth_N-terminal 118 dvFkkFkdeegnfkeslsedvkgllsLYeAshlstegeeiLeealsFtrkhL 169 dvFk+F+ ++g+fke+l d+kg+lsLYeA+hl t++e+iLeeal+Ft +L XP_006301390.1 50 DVFKRFQRKDGTFKECLVVDAKGMLSLYEAAHLETQTEKILEEALRFTPGQL 101 9***********************************************9999 PP >> XP_006294378.1 hypothetical protein CARUB_v10023396mg [Capsella rubella] # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 6.4 0.0 0.013 10 136 174 .. 36 74 .. 15 90 .. 0.79 2 ? 3.4 0.0 0.11 85 137 186 .. 105 159 .. 96 165 .. 0.66 Alignments for each domain: == domain 1 score: 6.4 bits; conditional E-value: 0.013 --------------------------------------- CS Terpene_synth_N-terminal 136 edvkgllsLYeAshlstegeeiLeealsFtrkhLkesls 174 ++++ llsL A s+++e+iL +s ++ hL++ l+ XP_006294378.1 36 TSINVLLSLIAAGSSSITREQILSFLMSPSTDHLNSVLA 74 67899*****************************65444 PP == domain 2 score: 3.4 bits; conditional E-value: 0.11 ------.------....-------------------------------------- CS Terpene_synth_N-terminal 137 dvkgll.sLYeAs....hlstegeeiLeealsFtrkhLkeslseelsdespnlae 186 ++k+ll + Y+As +++t+ ee+++e++++++ h + ++++ ls++s+++ e XP_006294378.1 105 SFKELLeNSYKAScsqvDFATKPEEVIDEVNTWAEVHTNGLIKDILSRNSSEIIE 159 45665425799985555578999***********999855666544333334544 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 28713 (11850150 residues) Passed MSV filter: 1492 (0.0519625); expected 574.3 (0.02) Passed bias filter: 779 (0.0271306); expected 574.3 (0.02) Passed Vit filter: 91 (0.0031693); expected 28.7 (0.001) Passed Fwd filter: 37 (0.00128861); expected 0.3 (1e-05) Initial search space (Z): 28713 [actual number of targets] Domain search space (domZ): 37 [number of targets reported over threshold] # CPU time: 0.56u 0.03s 00:00:00.59 Elapsed: 00:00:00.14 # Mc/sec: 16136.37 //